Protein Info for ABCV34_RS06930 in Castellaniella sp019104865 MT123

Annotation: glucose 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 13 to 164 (152 residues), 66.1 bits, E=6e-22
• PF00106: adh_short
  • amino acids 15 to 201 (187 residues), 176.7 bits, E=5.9e-56
• PF13561: adh_short_C2
  • amino acids 18 to 252 (235 residues), 203.8 bits, E=4.7e-64

Best Hits

Swiss-Prot: 32% identical to PTLF_STRAW: 1-deoxy-11-beta-hydroxypentalenate dehydrogenase (ptlF) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: None (inferred from 66% identity to pna:Pnap_2709)

MetaCyc: 32% identical to 11beta-hydroxy-1-deoxypentalante dehydrogenase (Streptomyces avermitilis)
RXN-12658 [EC: 1.1.1.340]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• neopentalenoketolactone and pentalenate biosynthesis (2/11 steps found)
• pentalenolactone biosynthesis (1/10 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.340

Protein Sequence (276 amino acids)

>ABCV34_RS06930 glucose 1-dehydrogenase (Castellaniella sp019104865 MT123)
MQDPHWLGLQGRAYAVTGAARGIGQGIVQALADAGARIALLDHDAAACEETAAALRAQGT
DATAFACDASDPDSVARTAAAVHDALGPCAGLVNNAGILRPGALQDVDLQEWNRVLGVNL
TGYLLTARAFAARMRDNGGGSIVHIASISGSFPQTRSGAYSASKAGVMLMSRQMAVEWGA
DGIRSNTVCPGMIRTHLSAAFYAEPGNEQRRAAMTASRRVGETADIANAALFLLSPRSSY
INATDLAVNGGMDAMLMDMVPRPGFNDTAPRTATQQ