Protein Info for ABCV34_RS06910 in Castellaniella sp019104865 MT123

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 147 to 163 (17 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details PF06081: ArAE_1" amino acids 217 to 359 (143 residues), 25.4 bits, see alignment E=1.4e-09 PF13515: FUSC_2" amino acids 230 to 356 (127 residues), 100 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: None (inferred from 55% identity to pde:Pden_3511)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>ABCV34_RS06910 FUSC family protein (Castellaniella sp019104865 MT123)
MSDSPTTTDHAPIALPARRRDALRQILHTRRFEESLKLGTPPSVRNSALAGLQAGLTTAI
CVPLFLLSPWAHLAGFASLGALAALFGRFAPRRSRTGIVLQCAFWQTFAVFAMSATAWLG
WSPAAQLALMAISCGFYLLISFRHHFGAPGPLIFIFAVGGSMTDTLDLRQVAERTLATAI
AAVFAWLICIASESLRHPPTPERTFPKDPERSLGELGFMAIRVSIAAFIVVYASHALGMN
HPAWAAMGAVAVMQGSHLHISMHRALQRMAGTLIGATLAWLLLIQQPPAWPIVVALVLLQ
VLTEIIIGVNYGLAQTLITPMALLMTHLAAPTAASAAMAPERVIDTILGAIVGMVIALIL
SNADDRRSLAHHHQSSRQYG