Protein Info for ABCV34_RS06885 in Castellaniella sp019104865 MT123

Annotation: formate/nitrite transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 182 to 209 (28 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 9 to 247 (239 residues), 207.2 bits, see alignment E=1.3e-65

Best Hits

Swiss-Prot: 51% identical to NIRC_SHIFL: Nitrite transporter NirC (nirC) from Shigella flexneri

KEGG orthology group: K02598, nitrite transporter NirC (inferred from 52% identity to sil:SPOA0181)

MetaCyc: 51% identical to nitrite transporter NirC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-137

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABCV34_RS06885 formate/nitrite transporter family protein (Castellaniella sp019104865 MT123)
MYDDTIDGFVKAANAKLDHLRLAPHSFFISCMLAGAYIGLGIILIFALGSHLAPDIRPLV
MGLTFGIALILVVIAGAELFTGHTMVMTLRRYRGQGSWADAATVLCVSWAGNLCGAAVLV
GLFVMGGGGGLLSDPNGPLMAAAVAKMNAGAASLFARAVLCNWLVCLAIWMSARVSSDSA
RCIVIGWCLLTFIASGYEHSVANMTVLLLALAGHHPDSVSLSGMLWNLSWVTLGNLVGGA
ICVAGAYGISSSRRASLNTHGTTPNPDTPAARS