Protein Info for ABCV34_RS06880 in Castellaniella sp019104865 MT123

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 198 to 223 (26 residues), see Phobius details amino acids 255 to 272 (18 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details PF00122: E1-E2_ATPase" amino acids 161 to 225 (65 residues), 36.8 bits, see alignment E=1.5e-13

Best Hits

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ABCV34_RS06880 hypothetical protein (Castellaniella sp019104865 MT123)
MHAPSLLTPPPHMTDVMRRARRHMLARTGLAWLIMMQVMMLAFPGYLRHGARAADSQLAL
EQAIILMNWLSLILCVPLALYCAWPVWSGAWRDLRRGRIGMDVPVALGILAAFIPSVIAT
WRDAGEVYFDSVSMFVAFLLAARFLETCARQAVSGQPGGGRDAGLLRSADRLAFWFVCLQ
ILLAVLVGWYWWRTQPDHALAVTVALLVMSCPCAMSMSVPSALAARHAARLRIAAAGEGD
VAALDGATRRIALQNLYGSLVWHLLMTPLAAFGWVQPWLAAITMLLSTLAVAANAWRLTR
GGRGHAAPLLADPA