Protein Info for ABCV34_RS06850 in Castellaniella sp019104865 MT123

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 58 to 486 (429 residues), 491.2 bits, see alignment E=1.5e-151 PF12801: Fer4_5" amino acids 112 to 153 (42 residues), 37.2 bits, see alignment 9e-13 PF13746: Fer4_18" amino acids 236 to 341 (106 residues), 147.5 bits, see alignment E=7.2e-47 PF11614: FixG_C" amino acids 377 to 500 (124 residues), 92.6 bits, see alignment E=8.4e-30

Best Hits

KEGG orthology group: None (inferred from 76% identity to put:PT7_1441)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>ABCV34_RS06850 cytochrome c oxidase accessory protein CcoG (Castellaniella sp019104865 MT123)
MQKEPSQQDATQPPRDDPAWQPVRRIRKGSGGGTSPQVEKALAEVRSKIYPRSVQGNFAR
IRVLMVFLTQAIFYGLPWVQWGGRQAVLFDLGARKFYLFGMVLWPQDVIYLAVLLVLSAF
ALFLFTAMAGRLFCGYACPQTVYTEIFMWIEAKVEGDRLARIRLDEQPWNARKLRIKGTK
HFLWVVLALWTGYTFIGYFAPIRDLGAHLVAFDLGPWQWFWMLFYAFATWGNAGFMREAV
CKYMCPYARFQSVMVDDDTFVVTYDHVRGEPRGGRSRKIDHKEAGMGDCVDCSLCVQVCP
TGIDIRDGLQYMCIGCGACVDACDTVMDKMGYERGLIRYTSGNAITERLTQPQVRKRMLR
PRVLAYSALLGAIAIGFVFSLATRTTLRVDVIRDRGALGREVAGGQIENVYRLQIINSSE
TPVDLDLSATGVPGLVLRTADQGTNRVRVEGSSNRLVPVVLQAPANGLKPGLYDIRFETV
GTRGPGDTNTVIEQSSFYVPN