Protein Info for ABCV34_RS06310 in Castellaniella sp019104865 MT123

Annotation: sarcosine oxidase subunit beta family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR01373: sarcosine oxidase, beta subunit family" amino acids 4 to 407 (404 residues), 715.7 bits, see alignment E=7.7e-220 PF01266: DAO" amino acids 35 to 380 (346 residues), 238.4 bits, see alignment E=3.4e-74 PF00890: FAD_binding_2" amino acids 35 to 244 (210 residues), 26.3 bits, see alignment E=8.6e-10 PF13450: NAD_binding_8" amino acids 38 to 86 (49 residues), 24.7 bits, see alignment 4.5e-09

Best Hits

Swiss-Prot: 64% identical to SOXB_CORS1: Sarcosine oxidase subunit beta (soxB) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K00303, sarcosine oxidase, subunit beta [EC: 1.5.3.1] (inferred from 83% identity to bgl:bglu_2g04990)

MetaCyc: 64% identical to sarcosine oxidase beta subunit (Corynebacterium sp.)
RXN-22742 [EC: 1.5.3.24]

Predicted SEED Role

"Sarcosine oxidase beta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1 or 1.5.3.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>ABCV34_RS06310 sarcosine oxidase subunit beta family protein (Castellaniella sp019104865 MT123)
MSNRYSIFSLIRNGLSHNENWGRAWHSPEPKREYDVVVIGAGGHGLATAYYLAKVHGIHN
VAVLEKGWLGGGNTARNTTIVRSNYLWDESAQLYEKAMQLWEGLSQDLNYNVMFSQRGVM
NLAHNLQEVRDTQRRINANRYNGVDGEWLTPAQVQEIVPNINLNSRYPVLGGSFQRRGGV
ARHDAVAWGFARAADRLGVHIIQNCPVLNIRKKDGVVEGVETGKGFIKAKKVAVVVAGHS
SVLAEMAGVRLPIESHPLQALVSEPVKPCVHTVIMSNAVHAYISQSDKGDLVIGAGIDQY
LGYGQRGSFQSIEHTLQAIVEMFPSLSRVRMNRQWGGIVDVSPDACPIITKTGIKGLYFN
CGWGTGGFKATPGSGWVFAHTVAHDEPHPLNKAFSVDRFYSGHLIDEHGAAAVAH