Protein Info for ABCV34_RS06000 in Castellaniella sp019104865 MT123

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 238 to 258 (21 residues), see Phobius details PF00753: Lactamase_B" amino acids 19 to 196 (178 residues), 53.6 bits, see alignment E=5.8e-18 PF12706: Lactamase_B_2" amino acids 25 to 210 (186 residues), 46.3 bits, see alignment E=7.9e-16 PF10996: Beta-Casp" amino acids 248 to 367 (120 residues), 110.6 bits, see alignment E=1.4e-35 PF07521: RMMBL" amino acids 381 to 445 (65 residues), 70.5 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 76% identity to axy:AXYL_05454)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>ABCV34_RS06000 MBL fold metallo-hydrolase (Castellaniella sp019104865 MT123)
MPSLTFLGAAGTVTGSKHLLTHGDTRIMVDCGLFQGLANLRELNWQRLPVEPQSVDAVVL
THAHLDHCGYLPRLARDGFRGRIHATAATRDVAALILRDSAFLQEKDADFANRKGFSKHE
PALPLYGSADAERAIRLFHSVPLYHQQALPGEASLLLRRAGHILGATTAQVDIGGVRIAF
SGDLGRYNDLVMHDPDPVPDADYVVIESTYGDRLHEPGDPMQALGEVIERTVKRGGTVVV
PAFAVGRAQLLIYGMWLLRRAGRLRNVPIYLDSPMATSASDLMRAYPDDHRLPPHDYEAA
CDAVHCVRDVQESKALSANPYPKVIISASGMATGGRVLHHIAAFAPDHRNTLLFSGFQAA
GTRGRKLLVGGARETRIHGQWIPVNAEVTELPTLSAHADSNDLMRWLAGFQRRPRRVFIV
HGEPDASEALRVRIRRELGWDAIVPRQDQVCPL