Protein Info for ABCV34_RS05915 in Castellaniella sp019104865 MT123

Annotation: YeiH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 33 to 83 (51 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 35 to 333 (299 residues), 262 bits, see alignment E=2.9e-82

Best Hits

KEGG orthology group: None (inferred from 66% identity to put:PT7_0530)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>ABCV34_RS05915 YeiH family protein (Castellaniella sp019104865 MT123)
MLPISAVPHPLPAQGRMDARSGLDNPPRAPSRWYGVLLAAGLGVVAWELGHWLPLIGGPV
MGIVLGMLWRNLLGVSPVFVPGITYSSRQVLKWSIIGLGFGLSLGQVVQTGASSLAVTLV
TLTVAFVSAWLLGRWLGLDGHLRTLIGVGTAICGGSAIAAAAPIIKPDDHDTALAISTIF
LFNVVAVLVFPPLGHWMGLSDSGFGLWAGTAINDTSSVVAAGYSYSTAAGDIATIVKLTR
ATLIIPVCIGLALWTAWRARHAETRVSLARIFPWFILWFLVASGIRTLDLVPTFLLEPLH
LGSQFLIIMALTAIGLSSDLRRMALAGARPILLGLGVWAAVSVSSLGVQSLMGSL