Protein Info for ABCV34_RS05900 in Castellaniella sp019104865 MT123

Annotation: nitric oxide reductase transcriptional regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF01590: GAF" amino acids 19 to 131 (113 residues), 24 bits, see alignment E=1.7e-08 PF00158: Sigma54_activat" amino acids 185 to 351 (167 residues), 230.4 bits, see alignment E=3.7e-72 PF14532: Sigma54_activ_2" amino acids 186 to 356 (171 residues), 79.2 bits, see alignment E=1.3e-25 PF01078: Mg_chelatase" amino acids 201 to 326 (126 residues), 20.5 bits, see alignment E=9.7e-08 PF07728: AAA_5" amino acids 208 to 327 (120 residues), 42.9 bits, see alignment E=1.7e-14 PF07724: AAA_2" amino acids 209 to 332 (124 residues), 31 bits, see alignment E=8.9e-11 PF00004: AAA" amino acids 209 to 327 (119 residues), 22.6 bits, see alignment E=4.4e-08

Best Hits

Swiss-Prot: 64% identical to NORR2_CUPNH: Nitric oxide reductase transcription regulator NorR2 (norR2) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 76% identity to put:PT7_0536)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>ABCV34_RS05900 nitric oxide reductase transcriptional regulator NorR (Castellaniella sp019104865 MT123)
METQLLTDLATDLPDGVRLQRAATAIRQAFSCDAVGLLMLDSNDTLHLVAAAGLAHEALG
RRFVVGQHPRFATILSRREPTWFDPGSVLPDPYDGLLDDRKGLPLPVHDCMGMTLYHQDR
PWGIMTLDALNTGIFDEAAHTRLLRLGLILQAAVRMTDMERENRQLRQLGSSQQGIERIG
EVTEILGHSEAIQSLLHELDLVADSDLPILLLGETGVGKELFARRLHRHSRRSQQTMIQV
NCAALPESLAESELFGHVKGAFSGATSDRPGRFEAAQGGTLFLDEVGELPLSLQAKLLRV
LQNGEIQRLGTDQVIKTDVRIIAATNRDLKANTQAGLFRADLYHRLSVYPIPIPPLRERD
RDIQILAGHFLEFNRARLGLRGVRLSYGAERALQQYPWPGNVRELEHVISRAALKMLSRG
ASRDQVLTIEAELLDLDIEPQPAALSKTGVPPGESAPGALAGADAANMPPLDIENIPLLR
TSVDACQRQAIRQALVAAGDNWAQAARALGLDASNLHKLAKRLGLKNRIDE