Protein Info for ABCV34_RS05885 in Castellaniella sp019104865 MT123

Annotation: cytosine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 328 to 353 (26 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 33 to 283 (251 residues), 51 bits, see alignment E=5.1e-18

Best Hits

KEGG orthology group: None (inferred from 66% identity to pol:Bpro_2332)

Predicted SEED Role

"Predicted hydroxymethylpyrimidine transporter CytX" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>ABCV34_RS05885 cytosine permease (Castellaniella sp019104865 MT123)
MNQNTSPSRQRPVRANAGRRPDATGSSAGTPGIPEVERVFGWHDHMALWFSLGVGLLVIQ
VGAYLAPALGTRGALIAVIAGSILGAGLLAWVARLGCDSGLSSAGLIHAVYGQRFAHLPV
LLNVVQLLGWATFELVIMRDGTQAIAEKAFGVNTGLIVPTLFWGLIVLLLLRGSMVTLVR
RIVSRIGLPLVVLSLIWLTVQFGLKLDAPGLRALWQRTGDGSMNTFQALDLVIAMPVSWL
PLVADYARHGRSGRGALGGTWLGYTIANIWCYALGVLVITVTGPDVDMVNALLLAQGGLL
ALGLILIDELDNTYGDLYSGSVCSHSLLPAFGLKTWGTLLAALSIALAMVLPMHSLEPFL
LALSSVFVPLFGTILGRLGMRPDRLTDTPRGFHAIPAGIWVLGIACYHFLAQWAPDYGSA
LPTLLLTFTLGALTARNGFRSAEPARS