Protein Info for ABCV34_RS05745 in Castellaniella sp019104865 MT123

Annotation: flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 136 (133 residues), 165 bits, see alignment E=3.9e-52 amino acids 146 to 244 (99 residues), 103.8 bits, see alignment E=1.6e-33 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 260 (257 residues), 376.7 bits, see alignment E=6e-117 PF00460: Flg_bb_rod" amino acids 7 to 35 (29 residues), 41.5 bits, see alignment (E = 1e-14) PF06429: Flg_bbr_C" amino acids 184 to 261 (78 residues), 89.2 bits, see alignment E=1.5e-29

Best Hits

Swiss-Prot: 71% identical to FLGG_ECOL6: Flagellar basal-body rod protein FlgG (flgG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 87% identity to put:PT7_0768)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABCV34_RS05745 flagellar basal-body rod protein FlgG (Castellaniella sp019104865 MT123)
MIRSLWIAKTGLETQQTSMDVISNNLANVNTTGFKRSRAVFEDLMYQTVRQPGAAVGAAN
QLPSGLQLGTGARTVATERIHSQGDLKQTGNALDVAIQGNGFLQVEMPDGSFAYTRDGSI
QRDQNGMLVTAGGYPIQPGINIPDNALSITIARDGTVSVTQPGATGTNVQVGQLQLATFI
NPTGLQSQGENLYVETDASGPANLLQPGLEGAGVLLQNYVETSNVNVAEELVNMITTQRA
YEMNSKAVQTSDQMLARLTQM