Protein Info for ABCV34_RS05730 in Castellaniella sp019104865 MT123

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02541: flagellar rod assembly protein/muramidase FlgJ
  • amino acids 18 to 318 (301 residues), 315 bits, E=3.7e-98
• PF10135: Rod-binding
  • amino acids 59 to 106 (48 residues), 36.5 bits, 5.7e-13
• PF01832: Glucosaminidase
  • amino acids 184 to 320 (137 residues), 117.2 bits, E=7.1e-38

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 60% identity to put:PT7_0771)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (323 amino acids)

>ABCV34_RS05730 flagellar assembly peptidoglycan hydrolase FlgJ (Castellaniella sp019104865 MT123)
MAYVTQTPLPSSGAQPSVLDFSSLNTLKRGVQAGANAPADKQREVARQFEAVFIQMMLKQ
ARQTSDQMPTLLDSQATRMARSLGDEQAALALANPGLGLADALMAQMQGNSGQKAADPLA
NPPEAARSRLPGLQSRIGEGRRQVADSIASLIDVLTQRRLGQKVSSAIQGAPDHIRTFVD
QMAAAADVASRRSGVPAKLILSQAALESGWGQREITRPDGSSSHNLFGIKAGRGWHGEVV
QAMTTEYIDGEPRKMVQPFRAYASYADSLTDYANLISQSDRYSAVMTARSAEDAARKVQA
AGYATDPSYADKLISIMGYFNAR