Protein Info for ABCV34_RS05695 in Castellaniella sp019104865 MT123

Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 30 to 57 (28 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 30 to 226 (197 residues), 295.8 bits, see alignment E=7.4e-93 PF00813: FliP" amino acids 30 to 222 (193 residues), 271.5 bits, see alignment E=2.3e-85

Best Hits

Swiss-Prot: 74% identical to FLIP_SALTY: Flagellar biosynthetic protein FliP (fliP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 80% identity to put:PT7_0779)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABCV34_RS05695 flagellar type III secretion system pore protein FliP (Castellaniella sp019104865 MT123)
MAQATLPALTATPGPNGSETWSLSVQTLVMLTMLSFLPAALLMMTSFTRIIIVLGLLRNA
LGTGVSPPNAVLVGLALFLTFFTMSPVFDQIYTQAYQPLAGDKITFEQALDRGAGPLKAF
MLHQTREADLSMFADMAKVGPLETPEATPLRVLVPAYVTSELKTAFQIGFTIFIPFLIID
LVVASLLMALGMMMVPPVTISLPFKLMLFVLADGWHLLLGSLARSFYQ