Protein Info for ABCV34_RS05690 in Castellaniella sp019104865 MT123

Annotation: flagellar biosynthetic protein FliO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 13 to 81 (69 residues), 71.4 bits, see alignment E=2.6e-24 PF04347: FliO" amino acids 25 to 104 (80 residues), 68.6 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 38% identical to FLIO_SALTI: Flagellar protein FliO (fliO) from Salmonella typhi

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 43% identity to bpt:Bpet2138)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>ABCV34_RS05690 flagellar biosynthetic protein FliO (Castellaniella sp019104865 MT123)
MDQAQILRVILALLFILGLLLALAWAARRGGWLRGPSGASNLRILGTHSLGTRCSIAVVQ
IDDTRLVLGVTAQQVTLLHTLPAAPDAPPTRPTGNFADTLGKTLSRS