Protein Info for ABCV34_RS05380 in Castellaniella sp019104865 MT123

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF02729: OTCace_N" amino acids 11 to 151 (141 residues), 173.3 bits, see alignment E=3.5e-55 TIGR00658: ornithine carbamoyltransferase" amino acids 11 to 307 (297 residues), 370.3 bits, see alignment E=3.5e-115 PF00185: OTCace" amino acids 157 to 305 (149 residues), 166.7 bits, see alignment E=4.5e-53

Best Hits

Swiss-Prot: 82% identical to OTC_BORPE: Ornithine carbamoyltransferase (argF) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: None (inferred from 85% identity to put:PT7_0683)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABCV34_RS05380 ornithine carbamoyltransferase (Castellaniella sp019104865 MT123)
MSAANPTGPLRHFLQLRDFSEDEIHYVIDRARLIKDKFKRYQPHHTLHDRNLAMVFEKAS
TRTRVSFEAGMYQLGGSVIYLTTEGSQLGRSEPIEDTARVISRMVDLVMIRTFEQTRIER
FAAHSRVPVINGLTNEFHPCQILADIQTFVEHRGPIQGKTVAWIGDANNMAYTWLQAAEL
LGFTLHVSAPAGYRLDPLRVGRQPESVLREFDDPTDACRGADLVTTDVWTSMGYETENET
RRLAFADWCVDARMMSVARPDALFMHCLPAHRGEEVTGEVIDGPQSVVWDEAENRLHVQK
ALMEFLLLGRQPA