Protein Info for ABCV34_RS05300 in Castellaniella sp019104865 MT123

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 47 to 71 (25 residues), see Phobius details amino acids 92 to 117 (26 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF04403: PqiA" amino acids 44 to 197 (154 residues), 101.8 bits, see alignment E=1.7e-33 amino acids 247 to 401 (155 residues), 162.6 bits, see alignment E=3.3e-52

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 49% identity to bbr:BB2021)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>ABCV34_RS05300 paraquat-inducible protein A (Castellaniella sp019104865 MT123)
MASRPLIACPHCDTLHERLDPGARGLAVCRCCETVLYRRGMLSLRQWVALGWTTLIVFAL
AQGFPIAILSVQGLDVSLTFWGALRLCWDRGYYGVSIMTGLVGFWFPLVWISLTLWVMQA
VANRRLPPDLGGTLRWLARLAPWSMATVLVLAILVAMVKFAGMAQLRIGPGLVGFFLLSF
MLSGMGRWDARALWREAEDAGMVLMSGRLGTGAVCESCGCVQAPPVSGRCRRCDAPLHER
RHDEAAQVWALLLAAIIFYIPANTLPIMRVQTLLGASNHTILGGVIELWRLGSWDLALIV
FVASVLVPVTKMLALSFLLLRSKPRGVRVQRQRTRLYAVVEFVGQWSMLDVFVVVLMTAM
ANFPGLSRIDVGPAALNFGAVVVLTMWAALRYDPRRGWERLRAARPDKDDHDD