Protein Info for ABCV34_RS05295 in Castellaniella sp019104865 MT123

Annotation: MlaD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details PF02470: MlaD" amino acids 58 to 149 (92 residues), 45.6 bits, see alignment E=3.4e-16 amino acids 178 to 237 (60 residues), 31.7 bits, see alignment 7.3e-12 amino acids 312 to 416 (105 residues), 48.4 bits, see alignment E=4.7e-17

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 52% identity to put:PT7_0704)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>ABCV34_RS05295 MlaD family protein (Castellaniella sp019104865 MT123)
MTTDEEQHNLEAAQAPEPALTPTIRLGRSLRWSWVWLVPLLALAVALSLLASVWVRTGPV
ITISFLSAAGIEAGQTKLRYRDVVVGLVKDVRVADDREHVLVDVQLDRDGSSYITQKGAK
FWIVRPQVSLAGVSGLDTLLSGMYLSVDAPTTPPKGSAVYFFEGLANPPEVLSGQVGTRF
QLVSSSLGSLVVGSRVYYRRIEVGRVVGYTMAPDGRAVDLQIFVQAPYDRYVTPDTRFWN
DSGIDMSLSAEGVQLRTSGLSAVLNGGVAFAQPDESSSYDGTVDSTPAKAGSSYTLFDTR
DQALADPDGPATEIELRFDQSVRGLRVGADVDFRGMPIGKVIDIDLEFDKTRKRFYSRVR
ALVYPMRFSQAYRDLVKSVNGAQGAALLGPLIRNGLRAQLRTASLLTGQQYVALDFFPDQ
AHARIQIPGDAPSAGYLLPTVPGDFDQLQRQLSSIVTKLDKLPLEDLGRELQGSLTNLRK
LLGRLDTQVVPQANQTLESARRSLDRVGAVLGPDAPVLGNLQDTLQALDGAARALRLLVD
SLQAHPESLLRGRSPDRLR