Protein Info for ABCV34_RS05175 in Castellaniella sp019104865 MT123

Annotation: 50S ribosomal protein L3 N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 8 to 292 (285 residues), 405.8 bits, see alignment E=9.9e-126 TIGR00536: methyltransferase, HemK family" amino acids 10 to 290 (281 residues), 236.4 bits, see alignment E=3.4e-74 PF02384: N6_Mtase" amino acids 120 to 211 (92 residues), 21.1 bits, see alignment E=8.2e-08 PF03602: Cons_hypoth95" amino acids 124 to 213 (90 residues), 30.9 bits, see alignment E=9.8e-11 PF05971: Methyltransf_10" amino acids 128 to 213 (86 residues), 28.3 bits, see alignment E=5.2e-10 PF05175: MTS" amino acids 130 to 213 (84 residues), 58.2 bits, see alignment E=3.7e-19 PF13847: Methyltransf_31" amino acids 131 to 262 (132 residues), 37.4 bits, see alignment E=9.8e-13 PF06325: PrmA" amino acids 131 to 205 (75 residues), 36.9 bits, see alignment E=1.4e-12 PF09445: Methyltransf_15" amino acids 131 to 207 (77 residues), 24.3 bits, see alignment E=9.2e-09 PF13649: Methyltransf_25" amino acids 133 to 205 (73 residues), 37.3 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 67% identical to PRMB_BORPE: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 69% identity to bpt:Bpet2801)

MetaCyc: 49% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABCV34_RS05175 50S ribosomal protein L3 N(5)-glutamine methyltransferase (Castellaniella sp019104865 MT123)
MAAPHTELLTLRDLLRWAITRFRGANLVFGHGSDNAWDEAVYLLLHTLHLPLDTLEPFLD
ARLLERERQRCVDLIHERVNTRKPAAYLTGEAWLQGQRFLVDERVIVPRSPIAELLGEQL
APWIEDPESITRVLDLCTGSGCLAILAAQAFESAQVDAADISTDALSVAQSNIALHELQD
RVRTLRSDLLSQIPENRRYDLILCNPPYVNSRAMTALPPEYRHEPRLALAGGEDGMDLVR
RILADAPRHLTPDGLLVLEIGHEQAHFQAAFPDLDPVWLSTETASDQILLLRQAQLTA