Protein Info for ABCV34_RS04995 in Castellaniella sp019104865 MT123

Annotation: lipoprotein-releasing ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 27 to 55 (29 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 324 to 352 (29 residues), see Phobius details amino acids 360 to 371 (12 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 422 (417 residues), 458 bits, see alignment E=1.5e-141 PF12704: MacB_PCD" amino acids 35 to 250 (216 residues), 68.7 bits, see alignment E=8.7e-23 PF02687: FtsX" amino acids 283 to 416 (134 residues), 71.7 bits, see alignment E=5.6e-24

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 76% identity to put:PT7_0828)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>ABCV34_RS04995 lipoprotein-releasing ABC transporter permease subunit (Castellaniella sp019104865 MT123)
MAYEWWIGARYAGLARTGRGGRRGDRFVSFVAASSMAGIGLGVAALIIVLSVMNGFQTQV
RDRMLSVLPHIELFVPGADHQQVLDHWQDLARAAEGDPEVRGAAPFVAAQGMLARGQGLS
GVQVRGIDPAIESKVSDLKGQMESGSLDSLTPGSFNMIVGSQIAQSLGLTVGDTVLLLAP
QGSISPAGFAPRMRQFTVSGIFATGYYEYDATLAFVDVQDAARVFRDSGVSGVRLRIADM
QRAPEVARQLLGLMPSGVRAMDWTQNNRTWFAAVKTEKRMMFLILALIVAVAAFNLLSSL
VMAVKDKQSDIAILRTLGATPAEIARIFLVQGALIGVVGTAAGVLFGTLAAYNIDVIVPW
IERLFGVHFLPQQIYFISELPSNPQVGDIVTIGVTSLVLSLLATLYPSWRASRLQPAQVL
RHD