Protein Info for ABCV34_RS04905 in Castellaniella sp019104865 MT123

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 7 to 472 (466 residues), 548.7 bits, E=1e-168
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 7 to 453 (447 residues), 633 bits, E=1.4e-194
• PF00571: CBS
  • amino acids 95 to 138 (44 residues), 48.2 bits, 2.3e-16
  • amino acids 148 to 201 (54 residues), 34.4 bits, 4.5e-12
• PF03060: NMO
  • amino acids 207 to 372 (166 residues), 38.2 bits, E=2.3e-13
• PF01070: FMN_dh
  • amino acids 255 to 363 (109 residues), 30.6 bits, E=3.8e-11

Best Hits

Swiss-Prot: 65% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 90% identity to put:PT7_0844)

MetaCyc: 63% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (486 amino acids)

>ABCV34_RS04905 IMP dehydrogenase (Castellaniella sp019104865 MT123)
MRLIKKALTFDDVLLVPAYSQVLPRDARLTTQLTRGIQLNIPLVSAAMDTVTESGLAIAM
AQEGGIGIVHKNLSADEQAREVARVKRHEFGIVIDPVTVTPTMKVRDAIELQRQHGISGL
PVVEGGKLVGIVTNRDLRFEDRLDMSLREVMTPQDRLVTLTEGATLEEAQALMHKHRLER
VLIVNDKFQLRGLATVKDIVKNTEHPLASKDAQGQLRVGAAVGVGEGTGERVEKLAAAGV
DVIVVDTAHGHSAGVIERVRWVKKHYPNIQVVGGNIATAAAARALVEAGADAVKVGIGPG
SICTTRIVAGVGVPQITAIADVAQALEGTGVPLIADGGIRYSGDVAKALAAGASTCMMGG
MFAGTEEAPGEVVLFQGRSYKSYRGMGSLGAMADGSADRYFQDPSNNVDKLVPEGIEARV
PYKGSVIAIIYQLVGGIRASMGYCGCATIPDLHAQAEFVEITAAGVRESHVHDVQITKEA
PNYRAD