Protein Info for ABCV34_RS04665 in Castellaniella sp019104865 MT123

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 PF00563: EAL" amino acids 36 to 256 (221 residues), 142 bits, see alignment E=3.2e-45 PF00990: GGDEF" amino acids 435 to 534 (100 residues), 52 bits, see alignment E=1.1e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 444 to 539 (96 residues), 55 bits, see alignment E=4.1e-19

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (623 amino acids)

>ABCV34_RS04665 GGDEF domain-containing protein (Castellaniella sp019104865 MT123)
MWSLPDPKQPARLAADVGPGIDPASADRDLILGGVLDAVFQPIVWLREGAALGYEGLIRG
PRDSRLYSPEPLFSAARALGQGVTLELRAARVVVERFAALGLPGRLFLNISPQALLATCE
SEPSLPALLLQAGLDISRLVVEVTEQEVDGNWSELAAVIAVLQAQGVQFAIDDLGTGFSN
LGRWLKLRPKYIKTDKAFVRGIQDDLLRQQMLRSISDIAAVAGAIVVAEGIETVDELACV
CDQGISCAQGYYIDRPQAQPSRRAWTGLSSDLTTLRLDALRCCAEPGLPQDDEQGWALQL
LRRVPSVTSQMSSEAVFSLFLGKPGLYTIPVVEDGCPLGVLKRSSLVERFSLPFQRELYG
KSPCRLFMDSKPLIVDMHTPLLTLSRWLAEAEGHALATDFIITGRGRYLGVGSSQDLLQA
LNRLQLRAARHANPLTQLPGNVPIDRQIQRYLGSGLQFAVCYADLDHFKPFNDIFGYRLG
DDVIRLLSRILSRHVDEQHDFLGHIGGDDFIILLRSADWRARCERMLADFTREIRQLMIE
AGQGAVENYEAEDRQGLHRRYSLPALSLGLVRVEPGAFQSRHQIAQAASEAKSQAKKHPG
STLFVDRRAAPENSVLEFTSFGA