Protein Info for ABCV34_RS04485 in Castellaniella sp019104865 MT123

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF02729: OTCace_N" amino acids 90 to 229 (140 residues), 149.1 bits, see alignment E=1e-47 TIGR00670: aspartate carbamoyltransferase" amino acids 90 to 398 (309 residues), 298.8 bits, see alignment E=2e-93 PF00185: OTCace" amino acids 242 to 396 (155 residues), 103.4 bits, see alignment E=1.3e-33

Best Hits

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 87% identity to put:PT7_1358)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>ABCV34_RS04485 aspartate carbamoyltransferase (Castellaniella sp019104865 MT123)
MAVSQQVFLRDAMRRLNLTRDVFAARIGVKRRALDTWLLPEGSQEARTMPEVVSRFVTEI
VENGALTEKYAQSAQSGPLRERIAIDNKHQLLSVDQFSRESVEDLFRVADLMQPIARRQK
VSRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVM
SGYVDAMVIRHPEKGSVAEFAAATNIPVVNGGDGAGEHPSQALLDLYTILTEFSRLGKLL
DGAHIVMAGDLKYGRTVHSLIKLLALYRGLKFTLVSPPGLEMPEYLLEQVSKNGHVLEQT
HDLAAGLKGADVIYATRVQKERFTGENLEGYSADFQVNRAIVDASCGPDVIVMHPLPRDS
REGAYDLSTDLNHDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSLRDVTWTPPSHIG
PDDSVFHGMY