Protein Info for ABCV34_RS04460 in Castellaniella sp019104865 MT123

Annotation: recombinase RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02012: protein RecA" amino acids 11 to 332 (322 residues), 568 bits, see alignment E=3.1e-175 PF00154: RecA" amino acids 14 to 276 (263 residues), 480 bits, see alignment E=4.9e-148 PF08423: Rad51" amino acids 44 to 234 (191 residues), 33.5 bits, see alignment E=6.9e-12 PF06745: ATPase" amino acids 47 to 223 (177 residues), 39 bits, see alignment E=1.5e-13 PF21096: RecA_C" amino acids 279 to 335 (57 residues), 93.5 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 90% identical to RECA_BORA1: Protein RecA (recA) from Bordetella avium (strain 197N)

KEGG orthology group: K03553, recombination protein RecA (inferred from 91% identity to axy:AXYL_01868)

MetaCyc: 70% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>ABCV34_RS04460 recombinase RecA (Castellaniella sp019104865 MT123)
MDERTGKANPERAKALAAALSQIEKQFGKGSIMRYGDNQVEHDIQVVSTGSLGLDIALGV
GGLPRGRVVEIYGPESSGKTTLTLQVIAEMQKIGGTCAFVDAEHALDVQYASHLGVNLED
LLISQPDTGEQALEITDALVRSGSVDLIVIDSVAALVPKAEIEGDMGDSLPGLQARLMSQ
ALRKLTATIKRANCMVIFVNQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKK
GDEVVGNETRVKVVKNKVAPPFKQVEFDIMYGTGISREGEIIDLGVQAGFIDKSGAWYSY
NGNRIGQGKDNVRDYLKEHADLAFEIENRVREHLGITLRAESAGGNSGGLSAAVNE