Protein Info for ABCV34_RS04425 in Castellaniella sp019104865 MT123

Annotation: hydroxymethylbilane synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00212: hydroxymethylbilane synthase
  • amino acids 7 to 297 (291 residues), 344 bits, E=2.9e-107
• PF01379: Porphobil_deam
  • amino acids 7 to 213 (207 residues), 275 bits, E=3.8e-86
• PF03900: Porphobil_deamC
  • amino acids 227 to 296 (70 residues), 70.8 bits, E=1e-23

Best Hits

Swiss-Prot: 75% identical to HEM3_BORPD: Porphobilinogen deaminase (hemC) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 75% identity to bpt:Bpet2065)

MetaCyc: 56% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (5/6 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• tetrapyrrole biosynthesis II (from glycine) (2/4 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (11/33 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (4/26 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (11/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Protein Sequence (312 amino acids)

>ABCV34_RS04425 hydroxymethylbilane synthase (Castellaniella sp019104865 MT123)
MSAPEKLVIATRASRLALWQAHHAQSRLRALYPDCRVELLEMTTRGDQILDRTLSKVGGK
GLFVKELETALLDGRADLAVHSLKDVPVDLTQPFALAAVLQRADPCDALVSNTAASLDDL
PAGAVVGTSSLRREAQLRARYPQLLVKPLRGNLDTRLAKLDRGDYAAIVLAAAGLQRLGL
SERIRSVLPVDLSLPAAGQGALGIETLASRTDLRSWLEPLVCRETTACVLAERAVSRALG
GSCQVPLAAYAVLHADELFLRGLVAEPDGSRVLRAQARGAADQAEALGESVARDLLGQGA
DAILARLSSTDA