Protein Info for ABCV34_RS04070 in Castellaniella sp019104865 MT123

Annotation: outer membrane protein assembly factor BamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 790 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 33 to 790 (758 residues), 838.4 bits, see alignment E=2.9e-256 PF07244: POTRA" amino acids 34 to 100 (67 residues), 24 bits, see alignment E=5.2e-09 amino acids 102 to 181 (80 residues), 41.6 bits, see alignment E=1.7e-14 amino acids 185 to 272 (88 residues), 62.5 bits, see alignment E=5.2e-21 amino acids 275 to 353 (79 residues), 42.2 bits, see alignment E=1.1e-14 amino acids 356 to 430 (75 residues), 56.8 bits, see alignment E=3e-19 PF01103: Omp85" amino acids 457 to 790 (334 residues), 230.3 bits, see alignment E=4.7e-72

Best Hits

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (790 amino acids)

>ABCV34_RS04070 outer membrane protein assembly factor BamA (Castellaniella sp019104865 MT123)
MSSLRNSRLIKRAIPVVLAALLAPAVAAAFTPFVVRDIQVQGIERVDPGTIFTYLPVKIG
QTFTEEEAATAIQKLYGTGFFSDVKIDARGNVLVVSVKERATIASINFNGMREFDAKALT
KSLSQVGFGQGRIFDQAMLDRAVFELKQQYLSKGKYGVQINPVITPLPRNRVGVSFDIFE
GEVTTIGKIEFIGNKAFSAGTLEDQMQLTTGGMMTWYTGTNKYSREKLEGDVERIRSYYL
DRGYLEFSMEPPQVTISPDRKSIYITMTVHEGEPYKLGPVDMAGDLLGLEDKLKPIITVH
EGETFSAEKTNAIAKSMTDYLGSLGYAFANVNPSPVLDHDTHVAKLTFYVDPGRRVYVRR
INVGGNTRTRDQVVRREMRQQEAAWYDSSSIKTSKDRIDRLGYFSEVDVKTDPVPGSPDQ
VDVDVNVKEKPTGMINLGVGYGTTDKLMLSAGISQDNVFGSGNSLSLNVNTSATNRAAVI
SHTNPYWTQDGISKTTSIYYRRTTPYAVADSGSLGWYAVESLGLGLNFGVPISETDRVFA
GATFERNSLRDMTMGTDLNLNPAPLAYQNFVDQYGDTTNAVIGSLGWAKDTRDSALAPHK
GSYTRLSADVSTMDLKYYKLSGQQQFFWPMGRSFTLALNGQADWEKTYGSSGKAFPVIKN
MYAGGIGSVRGYEGASLGPRDTLTNTYLGGSRRIVGNLQLYLPFPGATRDRTLRWFLFTD
AGQVANTDSSPCTQGINNGVSDPCGWKFSAGIGLSWESPLGPLQLSFGRPLNAKDGDEKQ
LFQFQIGTGF