Protein Info for ABCV34_RS04050 in Castellaniella sp019104865 MT123

Annotation: acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 6 to 262 (257 residues), 333.2 bits, see alignment E=4.4e-104 PF00132: Hexapep" amino acids 15 to 50 (36 residues), 35.7 bits, see alignment 4.8e-13 amino acids 107 to 141 (35 residues), 31 bits, see alignment 1.5e-11 PF13720: Acetyltransf_11" amino acids 178 to 262 (85 residues), 87.1 bits, see alignment E=8.4e-29

Best Hits

Swiss-Prot: 56% identical to LPXA_BURP0: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Burkholderia pseudomallei (strain 1106a)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 74% identity to put:PT7_1038)

MetaCyc: 48% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>ABCV34_RS04050 acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Castellaniella sp019104865 MT123)
MTTARIHPTAIVAPGAVLGDDVSVGPYSIIGEHVRIGAGTRVGPHCVIDGHTTIGPNNHF
YRFCSIGGIPQDKKYQGEPTALEIGAGNTFREHVTINIGTVQDVGTTRLGDDNWIMTYVH
IAHDCQLGSHIVIANSVQLGGHIHIGDWAIIGGLSAVHQFVRIGAHAMIGGTSSVRQDVP
PYMIGAGDSFRPVGINSEGLGRRGFTPDDIQVLKEAYKTLYRRQFNIEQAADALVDLQQA
HPSEAPVVQTLIDFLRASTRGIARP