Protein Info for ABCV34_RS03970 in Castellaniella sp019104865 MT123

Annotation: dTMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR00041: dTMP kinase" amino acids 4 to 194 (191 residues), 166.2 bits, see alignment E=3.6e-53 PF02223: Thymidylate_kin" amino acids 10 to 194 (185 residues), 151.2 bits, see alignment E=1.3e-48

Best Hits

Swiss-Prot: 62% identical to KTHY_BORPD: Thymidylate kinase (tmk) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K00943, dTMP kinase [EC: 2.7.4.9] (inferred from 65% identity to axy:AXYL_02837)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>ABCV34_RS03970 dTMP kinase (Castellaniella sp019104865 MT123)
MTRRGCFITLEGLDGAGKSTHLDWMAGWLRRAGLDLLCTREPGGTPLGESLRELVLHQSM
DLRTETLLMFAARNEHWRTVIRPALDQGRWVLCDRYTDASFAYQGGGRELGPEPIRILED
WVQQGQGPDCTFLFDVPLAVARQRLQQGRESADRFEREGAAFFERTRQAYHARVAADPAR
FHVIDAQRGIADIRATLEEALQALLRAHHDRTPATRTGPTA