Protein Info for ABCV34_RS03905 in Castellaniella sp019104865 MT123

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 145 to 172 (28 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF01618: MotA_ExbB" amino acids 102 to 220 (119 residues), 81.3 bits, see alignment E=2.6e-27

Best Hits

Swiss-Prot: 33% identical to YTXD_BACME: Uncharacterized 29.3 kDa protein in ccpA 3'region (ytxD) from Bacillus megaterium

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 69% identity to psa:PST_2516)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>ABCV34_RS03905 MotA/TolQ/ExbB proton channel family protein (Castellaniella sp019104865 MT123)
MNPSTLIGIVASILLLAIVLVFSAENPRLFIDLPGLGIVLVGTAAATFIAYPLREVMRVF
GLMRSIVHHEKLQIDKDLEDLVEIARIWMQSDIRTVEAALERVSNPFLRSGVQLVIDNVP
ESDILDLLQWRIARMKAKEHAEAQLFRVMAGFAPAFGMVGTLVGLVNLLFVLGGGDIAVI
GRQMALALMTTFYGVLLANLVFKPIAVKLERRTEQRLVLMNTIMQGISMMSQKRSPSLMR
ETLKAFVADVRDEIKDTEATPRAEPAA