Protein Info for ABCV34_RS03650 in Castellaniella sp019104865 MT123

Annotation: glyceraldehyde 3-phosphate dehydrogenase NAD-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 7 to 107 (101 residues), 108.6 bits, E=1.8e-35
• PF02800: Gp_dh_C
  • amino acids 164 to 319 (156 residues), 153.4 bits, E=3.9e-49

Best Hits

Swiss-Prot: 52% identical to E4PD_PSEHT: D-erythrose-4-phosphate dehydrogenase (epd) from Pseudoalteromonas haloplanktis (strain TAC 125)

KEGG orthology group: K03472, D-erythrose 4-phosphate dehydrogenase [EC: 1.2.1.72] (inferred from 65% identity to put:PT7_1166)

MetaCyc: 38% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.2.1.72)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• Bifidobacterium shunt (11/15 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• superpathway of glucose and xylose degradation (11/17 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• glycerol degradation to butanol (9/16 steps found)
• heterolactic fermentation (10/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.72

Protein Sequence (349 amino acids)

>ABCV34_RS03650 glyceraldehyde 3-phosphate dehydrogenase NAD-binding domain-containing protein (Castellaniella sp019104865 MT123)
MSAPLCLAINGYGRIGRCIVRALIESRYRETMHIVAINEPADLESMAYLTRFDSTHGVFP
GEIQAIESGLRIDGRDIPVFHEREPAAVPWGRLGLDVLLECSGAYATRERLQAFLNAGCP
RLLVSNPGRGAADVDCTVVHGVNDACLRADQHIVSAASCTTNAIVPVLDLLDRQLGVRSA
FLTTLHSVMNDQPMIDGYHHSDLRRTRSAMQSIVPVTTGLAQGVERLLPQLTGRVQAKAV
RVPILNVSAIDLTVNLTQATSVDALNTLFTDAASTCPGLLACTRQPHASIDFNHDPHSAI
IDLGQTRVNNGHFANLMVWFDNEWGFANRMLDIASGWSDLFRQIAAPSA