Protein Info for ABCV34_RS03645 in Castellaniella sp019104865 MT123

Annotation: D-2-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 28 to 319 (292 residues), 94.8 bits, E=3.7e-31
• PF02826: 2-Hacid_dh_C
  • amino acids 109 to 289 (181 residues), 178.5 bits, E=8.4e-57

Best Hits

Swiss-Prot: 45% identical to Y1556_HAEIN: Putative 2-hydroxyacid dehydrogenase HI_1556 (HI_1556) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00018, glycerate dehydrogenase [EC: 1.1.1.29] (inferred from 62% identity to atu:Atu5333)

Predicted SEED Role

No annotation

MetaCyc Pathways

• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• photorespiration II (6/10 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.29

Protein Sequence (324 amino acids)

>ABCV34_RS03645 D-2-hydroxyacid dehydrogenase (Castellaniella sp019104865 MT123)
MDPLRIVFLDRDTLPESIDLPPPQVPHELVCHARTAPDQVVERIREADIVVTNKVILTAD
MLHQAPRLQMIAVAATGTDNIDLDACNQRGIVVSNVRDYAVHTVPEHTFALMLALRRSLL
AYRQSVADGHWHESGQFCYFDFPVHDLAGSTLGIIGRGALGEAVAEIARAFDMKVQFAAR
RDADSPAEDYTSFTHVLRTSDVITLHCPLNPQTRGMIGANEFALMERKPLLINTARGGLV
DEYALDHALRTGQISGAGFDVASQEPPAPDHPLMKLLRYPNFILTPHVAWASLEAIQAMA
NQVRDNIEAFCRDAPRNVVAGFHA