Protein Info for ABCV34_RS03630 in Castellaniella sp019104865 MT123

Annotation: high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00005: ABC_tran" amino acids 22 to 182 (161 residues), 112.9 bits, see alignment E=2.8e-36 PF12399: BCA_ABC_TP_C" amino acids 232 to 254 (23 residues), 39.9 bits, see alignment (E = 3.8e-14)

Best Hits

Swiss-Prot: 62% identical to BRAF_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraF (braF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 88% identity to put:PT7_1173)

MetaCyc: 59% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivG (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ABCV34_RS03630 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (Castellaniella sp019104865 MT123)
MSESLLKVSGLTMRFGGLLAVDQVEFEVRKNEVFAIIGPNGAGKTTVFNCVGGFYKPSTG
AIVMDGKSINGLPSHKVARHGLVRTFQNVRLFKNLTVLENLMVAQHTLMETGLLQGLLKL
PSFRHSEIAAKKRAVQWLDFMGIRQYANREAGNLAYGHQRRLEIARCMITQPRLLMLDEP
AAGLNPQEKRDLSALIDQLRREYGVAVLLIEHDMSLVMGVSDRILVMEHGKPITTGLPEE
VRADPRVIKAYLGE