Protein Info for ABCV34_RS03610 in Castellaniella sp019104865 MT123

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 7 to 271 (265 residues), 248.5 bits, E=4.6e-78
• PF03807: F420_oxidored
  • amino acids 7 to 99 (93 residues), 43.9 bits, E=3e-15
• PF14748: P5CR_dimer
  • amino acids 169 to 271 (103 residues), 122.2 bits, E=1.1e-39

Best Hits

Swiss-Prot: 38% identical to P5CR_PEA: Pyrroline-5-carboxylate reductase (PROC) from Pisum sativum

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 65% identity to bav:BAV1898)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (2/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Protein Sequence (277 amino acids)

>ABCV34_RS03610 pyrroline-5-carboxylate reductase (Castellaniella sp019104865 MT123)
MKNTLSLALIGGGNMASALASGLIGRRCAAADVHVIDPGDDTRSRWEALGTTTATAPDAR
LSECRVWFFAVKPQVMAEVVRQCQPWLRPDTLVISIAAGIPGSAIAGWLGSGSVPYTRVV
RCMPNTPALIAAGMTGMTALSGVDDPDRVLAEELLRAVGDVLWVADDAAIDAVTAVSGSG
PAYVFLFLEALIAAGVEQGLTPEQARQLALATFHGATQLATLSPDSPAVLRERVTSKGGT
TAAALAVFQQHGLTDIMREAVSAAARRAGELAREFSR