Protein Info for ABCV34_RS03490 in Castellaniella sp019104865 MT123

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 347 (316 residues), 73.2 bits, see alignment E=9.8e-25 amino acids 227 to 383 (157 residues), 34.2 bits, see alignment E=6.9e-13

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 62% identity to put:PT7_3657)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>ABCV34_RS03490 MFS transporter (Castellaniella sp019104865 MT123)
MSGARVSTWGRWLTAASLLLLAANLRPLFPSTAVLLPDISRGLGLSAAASGYLTTLPVLC
MGIFAPFAPRCAQRIGIERTLLLVLLLITTGTALRGAFDAVGLFLGTALAGAGIALGNVL
LPSLVKRDFADRAALMTGLYTMSLVGGAALAAATTLPLMHKLGDQWTLSLAIWAVPGILA
LFAWSPVAWRAGSHHTNGRHILPVQGLRRDRLAWAVTLFMGLQSALAYCVLGWMAPILRD
RGLSGTEAGLVTSVSILLQVASCLLTPLLASRWRDQRGLAVGLTVVATFALIGMVLGPRW
AIWPLAVIQGIGQGGLFALALMLIVLRSHDAHVAAHLSSMAQATGYVLAASGPLLIGVLY
AWTGGFQAAAGLLGALGLCTALAGWQAGRNALVQARSIPESPKPAAA