Protein Info for ABCV34_RS03085 in Castellaniella sp019104865 MT123

Annotation: SurA N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF13624: SurA_N_3" amino acids 1 to 160 (160 residues), 142.4 bits, see alignment E=2.9e-45 PF13623: SurA_N_2" amino acids 3 to 138 (136 residues), 78.1 bits, see alignment E=1.6e-25 PF13145: Rotamase_2" amino acids 246 to 381 (136 residues), 73.9 bits, see alignment E=5e-24 PF13616: Rotamase_3" amino acids 259 to 366 (108 residues), 69.8 bits, see alignment E=7.5e-23 PF00639: Rotamase" amino acids 272 to 366 (95 residues), 87.7 bits, see alignment E=2.1e-28

Best Hits

KEGG orthology group: K03770, peptidyl-prolyl cis-trans isomerase D [EC: 5.2.1.8] (inferred from 59% identity to put:PT7_0984)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>ABCV34_RS03085 SurA N-terminal domain-containing protein (Castellaniella sp019104865 MT123)
MFDFIRTHQRLMQLVLLILVVPSFVFLGISGYSVVTADPAVAKVGKLTVTQQEFTQAQRN
QLQQMQESSQGRFDPALLDNPQARQALMDQLIDRKVQVAVATQDHFSVSDNTLRHAIAVM
PQLQVDGQFSSDRYHEVLASVGMTPRDFEAGQRAELALNTVLGPVRDTATLPQPVLDSLK
RALTEERIVRLRVFQADDYRKGVTISADDIKAWYEAHQDALRLPEQVSADYLVLDEAAAV
ASVPAISEAQLKDYYEQNKARYVIPARVNVSHILVKLPAGASDEAAKAALATAQDIARRA
RAEPAQFAGLARKESQDAGTAREGGVLGWIQRGTLPLDMEQAVFALKQGGISDPVKGPDG
YHIFMANEVQPEKGETFDQARAKVETEVRRQVAADRFADMATKLTGLVYDNPSSLDPAAK
DLGLQVGQAQGIARDRLLTTDEVGPKAAAASKDAAILGDARVRQALFSTQVLTDKQNSGV
IEISPDTMVVVRVGAVTPAHVPALDKVQAHIRAQLENERAQAAAVTEGEKVLAELRKKSS
SDGFQAPVTLSRLDPAGLNKVVLDAAFAVPHQSLPAYGGVSLPKAYAIVQVDQVKAGTTD
KPALDGLGTQLSQLWGGAEEKAVMADLRKTLGVKITAEGHKLIERGEGGSN