Protein Info for ABCV34_RS03050 in Castellaniella sp019104865 MT123

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 9 to 52 (44 residues), 35 bits, 2.1e-12
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 15 to 434 (420 residues), 327.2 bits, E=7.8e-102
• PF05958: tRNA_U5-meth_tr
  • amino acids 247 to 435 (189 residues), 55.8 bits, E=8.3e-19
• PF13847: Methyltransf_31
  • amino acids 291 to 365 (75 residues), 27.7 bits, E=4e-10

Best Hits

Swiss-Prot: 73% identical to RLMD_BORBR: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 73% identity to bbr:BB3014)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (441 amino acids)

>ABCV34_RS03050 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Castellaniella sp019104865 MT123)
MPAEPILYPLEIESLDLEGQGIAHHDGKVVFVEGALPGERVIARVTRRKPSFDKARVEQV
LRPSSQRTQPPCPHFGVCGGCAMQHLEPAAQVATKQRALEDALAHIGKVRPLQILPALQG
PTWGYRHRARLSVRLVPKKGGVLVGFRERASSYVADIRECRVLPPHVSALLMPLRSLIAG
LSHPDRMPQIEVAVGDQATVLCLRHLEPLSSADIERLREFGEAHRIVWWLQPKGPETAHP
LDPAQADALAYALPAYGLRMHYRPADFTQVNPYINQTLIARALSLLGVQPQDRVADLFCG
LGNFSLPLATQAREVVGIEGSATLVARAREDAARQGLGERTTFTELNLFEVDVAWLRGLG
HFDRMLIDPPREGALALAQALAALAPEERPRRIVYVSCNPATLARDAGMLCHVGGWTLKA
VGAVNMFPHTAHVESIAVFEP