Protein Info for ABCV34_RS02635 in Castellaniella sp019104865 MT123

Annotation: outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 9 to 379 (371 residues), 387.7 bits, see alignment E=2.2e-120 PF13570: PQQ_3" amino acids 50 to 88 (39 residues), 20.8 bits, see alignment 6.5e-08 amino acids 127 to 165 (39 residues), 21.6 bits, see alignment 3.6e-08 amino acids 264 to 301 (38 residues), 22.2 bits, see alignment 2.3e-08 PF13360: PQQ_2" amino acids 64 to 95 (32 residues), 20.7 bits, see alignment (E = 4.4e-08) amino acids 79 to 308 (230 residues), 202.4 bits, see alignment E=1.3e-63 PF01011: PQQ" amino acids 193 to 221 (29 residues), 21 bits, see alignment (E = 3.3e-08)

Best Hits

Swiss-Prot: 52% identical to BAMB_BORPE: Outer membrane protein assembly factor BamB (bamB) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: None (inferred from 60% identity to put:PT7_1398)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>ABCV34_RS02635 outer membrane protein assembly factor BamB (Castellaniella sp019104865 MT123)
MRTPVRLFRAAVISLSVVGLAGCGLFSRTDARFDPAPLTEYAPSLAVASRWSVSIGSGGD
YGFSPQVVGDTAYAATPSGAVAALDLASGAVRWRAGKDPLSAGVGTDGRTTAVVTQTGMV
VAYDAQGNEIWRSQAASAVNVPPAVGNGIVAVRTTDYRVQAFDESTGKLRWNVQRPGPAL
ALRTSMRMAMVPGTVIAGMPGGRLLVIDAASGAVRWEGSVSPSRGASDLERISDVVGEPV
TVGPLLCGVSYQGHTTCFDVSQGGRPIWSQEVSSATGMATDGQHIYLPDLRDTVHALDLR
DGHEVWKQSALLNRRLSSPAVVGSAVVLGDYQGYLHFLSRADGSLMARLQVGGGPITSAP
LSTPRGALIQTGSGNLMLVTTGG