Protein Info for ABCV34_RS02480 in Castellaniella sp019104865 MT123

Annotation: ribonuclease G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 TIGR00757: ribonuclease, Rne/Rng family" amino acids 15 to 428 (414 residues), 488 bits, see alignment E=1.2e-150 PF10150: RNase_E_G" amino acids 124 to 395 (272 residues), 334.8 bits, see alignment E=2e-104

Best Hits

Swiss-Prot: 50% identical to RNG_HAEIN: Ribonuclease G (rng) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 79% identity to put:PT7_0516)

MetaCyc: 52% identical to RNase G (Escherichia coli K-12 substr. MG1655)
Ribonuclease E. [EC: 3.1.26.12]

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.12, 3.1.4.-

Use Curated BLAST to search for 3.1.26.- or 3.1.26.12 or 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>ABCV34_RS02480 ribonuclease G (Castellaniella sp019104865 MT123)
MSLNEDILINVTPFETRVALTAQGVVQELHIERSVQRGHVGNLYLGRVARVLPGMQSAFV
DIGQERAAFIHVADLRQNRHARNSSEHIPHTPIEKLLFEGQPLLVQVIKDAMGTKGARLS
THISIAGRMLVYLPHEPHIGVSQRIDDEAERNALRERVQALQPADESGGFIVRTQAEGAS
DEELTADITYLRMLWVNIQARIREVPAPSPVYIELTLAQRVLRDMVTPETGAITIDSRTV
TQELIDWAQRYTPSVVERIHHYSGNRPLFDTANVDEEIARALSRRVDLKSGGYLIIDQTE
ALTTVDVNTGGYVGGRNFDDTIFKTNLEAAVAIARQLRLRNLGGIIVLDFIDMDDAGHQA
SVLAELHKTLSHDRTRVTVSGFSQLGLVEMTRKRTRDSLAHQLCEPCPTCQSRGSVRTPR
TLCYEILREILREARQFNPKEFRIVASQAVIDLFLEEESQHLAMLGDFVGKPISLAVEAG
YAQEQYDLVLL