Protein Info for ABCV34_RS02375 in Castellaniella sp019104865 MT123

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 258 (180 residues), 53.6 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 60% identical to POTI_ECOLI: Putrescine transport system permease protein PotI (potI) from Escherichia coli (strain K12)

KEGG orthology group: K11074, putrescine transport system permease protein (inferred from 79% identity to put:PT7_0489)

MetaCyc: 60% identical to putrescine ABC transporter membrane subunit PotI (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotI (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>ABCV34_RS02375 ABC transporter permease subunit (Castellaniella sp019104865 MT123)
MRRSSWFRFASLTIGYSFLYVPIACLMVFSFNDSTLMNSWSGFSLRWYASLFQDQALLSA
ARLSLVIALLTATAAVVIGTWAGYVLARMGRFRGFGLYIGMLSAPLVMPEVVLGISLLLM
FVELSKVIGWPDGNGMFTIWVGHVTLCTAYVAVIIQSRVRDLDRSLEEAALDLGASPLRV
FFVITLPLIAPALMAAWLLAFTLSLDDVVVAAFLSGPGYTTLPLEVFSRVRLGLKPEINA
LATLFMVVVGVIVVAVNRMRIQAAKRGAG