Protein Info for ABCV34_RS02030 in Castellaniella sp019104865 MT123

Annotation: IS256 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF00872: Transposase_mut" amino acids 39 to 393 (355 residues), 393.4 bits, see alignment E=1e-121 PF10551: MULE" amino acids 203 to 281 (79 residues), 29.8 bits, see alignment E=6.9e-11

Best Hits

Swiss-Prot: 60% identical to TRA3_RHIME: Transposase for insertion sequence element ISRM3 (R00164) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 74% identity to bvi:Bcep1808_1823)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>ABCV34_RS02030 IS256 family transposase (Castellaniella sp019104865 MT123)
MPVKHKKPSIAAQAAARTARFPKLPEHLLDGLVEGPMSAMEVEDLIDAFGKAVIERAMAG
EMNAHLGYRAGEDKPAQQADERNGVSAKTLLTKHGSMRVQLPRDRDGTFEPVLIPKHERH
FAGFDERIIALYARGMSVREIQAFLAETYGTDVSPELISEVTDEVMTETVAWQNRPLERM
YPVVFFDALRVKIRTDGLVVNKAVYLALGIDANGERDVLGLWIEQTEGSKFWLKVFNELK
NRGCQDILIAVVDGLKGLPEAINVVFPKTTVQTCIVHLMRNSLDYAGWKDRKLVAAALKP
IYAAANEQQAREALAAFAAGPWGTKYPTIVAAWERAWEHVVPFFIFPPDIRRVIYTTNAI
ENMNRQLRKIIKNRGQFPSDEAAVKLLWLALRNVLAKPSRSVHTWKAAMNQFAILFGERF
TEARD