Protein Info for ABCV34_RS01880 in Castellaniella sp019104865 MT123

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 7 to 251 (245 residues), 270.5 bits, see alignment E=6.4e-85 PF13512: TPR_18" amino acids 34 to 170 (137 residues), 134 bits, see alignment E=7.2e-43 PF13525: YfiO" amino acids 35 to 239 (205 residues), 201.3 bits, see alignment E=2.4e-63 PF13174: TPR_6" amino acids 74 to 105 (32 residues), 12.5 bits, see alignment 3.1e-05

Best Hits

Swiss-Prot: 42% identical to BAMD_NEIMB: Outer membrane protein assembly factor BamD (bamD) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K05807, putative lipoprotein (inferred from 78% identity to put:PT7_0437)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>ABCV34_RS01880 outer membrane protein assembly factor BamD (Castellaniella sp019104865 MT123)
MPSPARLALAGLFLALVAGCSSTSGNVDPTAGWSAERLYSQSRTDMSAGSWSDARKNLEA
LEARYPFGIYAQQALIDQAYVNWKDEEPEQAKAAIDRFMQQYPNHPGTDYMLYLKGMITF
TPPSAILSNITRQDPSERDPKGLRESYEAFNELIKRYPDSRYTPDARKRVAWLVNTIAEN
EVHVAQYYYERGAYVAAANRAQKVVTDFEGAPIVEKALYLMMISYQKLDLPKLADDAKRV
LDKNFPNSKYYKQGLNEPKSYWNPVNWL