Protein Info for ABCV34_RS01870 in Castellaniella sp019104865 MT123

Annotation: Tex family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 790 PF09371: Tex_N" amino acids 23 to 205 (183 residues), 225.6 bits, see alignment E=9.9e-71 PF16921: Tex_YqgF" amino acids 342 to 468 (127 residues), 169.3 bits, see alignment E=1.2e-53 PF12836: HHH_3" amino acids 508 to 572 (65 residues), 95.3 bits, see alignment E=5e-31 PF17674: HHH_9" amino acids 578 to 647 (70 residues), 79.7 bits, see alignment E=6e-26 PF00575: S1" amino acids 668 to 737 (70 residues), 79.1 bits, see alignment E=6.6e-26

Best Hits

Swiss-Prot: 71% identical to TEX_BORPE: Protein tex (tex) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K06959, uncharacterized protein (inferred from 73% identity to put:PT7_0435)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (790 amino acids)

>ABCV34_RS01870 Tex family protein (Castellaniella sp019104865 MT123)
MSTTSPTSSIHAVDPARVLRLLTAELDARPTQIAAAVDLLDSGATVPFIARYRKEATGGL
DDTVLRQLEVRLLYIRELEGRRIAILDSITQQGKLDDTLQAQILAADSKQRLEDLYAPYK
PKRRTRAQIAREAGLEPLADRLLDDPAADPESLATGYLNADAGFADAKAVLNGARDILAE
RFAEHAPLLESLRSELWNTGRIYAQVVAGKETEGEKFRDWFDFSETLRTLPSHRILALLR
GRQQGILDLRLGLDAEQEALTPHPCMVRVADVLRIDARFDAQASARQHWLADVCRWTWRV
KLLTAFETELIGRLRESAEMEAIRVFAANLKDLLLAAPAGPKAVLGLDPGIRTGVKVAAI
DATGKLLDTVTIYPFEPRRDVEGSLRALAAVMSRHKIPLVAIGNGTASRETERLVAALQE
RHPELKFDRIVVSEAGASVYSASELAAQEFPELDVSLRGAVSIARRLQDPLAELVKIEPK
AIGVGQYQHDVNQRELARSLDTVVEDCVNAVGVDVNTASAPLLTRVSGLNATLARNIVQW
REAHGAFANRRALLEVPRFGDKAFEQAAGFLRVPGSDNPLDASAVHPEAYPVVEQIVLRA
GRPAADLMGQPQALKGLSPADFTNERFGLPTVRDIFAELEKPGRDPRPEFKTARFKEGVH
DIKDLVPGMVLEGVISNVANFGAFVDIGVHQDGLVHVSALADKFVKDPRDVVRVGQTVEV
RVLEVDVTRKRIALSMRKDDPEPRQSARSDKPATGKPGGRTGQRGGRPDGAAGAPQGAMA
EAFARLQGKR