Protein Info for ABCV34_RS01595 in Castellaniella sp019104865 MT123

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 471 to 489 (19 residues), see Phobius details amino acids 503 to 521 (19 residues), see Phobius details amino acids 541 to 562 (22 residues), see Phobius details amino acids 605 to 624 (20 residues), see Phobius details amino acids 645 to 662 (18 residues), see Phobius details PF04205: FMN_bind" amino acids 117 to 193 (77 residues), 25.4 bits, see alignment E=1.9e-09 PF12801: Fer4_5" amino acids 545 to 591 (47 residues), 48.4 bits, see alignment 7.2e-17 amino acids 647 to 683 (37 residues), 27.6 bits, see alignment 2.3e-10

Best Hits

KEGG orthology group: None (inferred from 65% identity to bpt:Bpet4338)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (788 amino acids)

>ABCV34_RS01595 4Fe-4S binding protein (Castellaniella sp019104865 MT123)
MRPFRQSLSQPSNSWVWFGLLIVLAACLLATPIQSIAQPDSSRAHEAFKFGGGGTPLGNS
PRLGAFLNKVKPADIFPGADRIGPPEGKPTIARAYAADKMIGYVYLTTDIVNTRGYSSKP
IDILVGLTLEGKIVGVKLVEHHEPIVLIGIPEAKVQRFIDGYIGQNYVKEPPRPGAPPPV
DIISGATVTLMVIGDSIPRSVLAVARNYGIGQEAQTHAAPVEHRVIDMEKTGIQSWDELL
KTGAVSALRVSVADVNKAFEATGRQGAIDHPEPGDPKDTFIDLYAAVVSVPTIGRSLLGD
SDYNYLRDRLKPGQQAILVAGNGRYSFKGSGYVRGGVFDRIEVVQDENSFRFTDLDHQRL
ADIMAAGAPGFREIALFTAPTNAVFDPTAAWRLQLSVQRIINVKEKAFTAFVLNYQLPAA
FTKVETPATPAAQPASTAASSSAAPTQAPAAAQDNAPALWKQIWKAKTTQIIVISIALLA
LIGVFFFQNQLVKNEVIYRRFRTGFLIFTLFWIGWYAQAQLSVVNVLTFTTSLRTDFSWE
YFLMDPIVFILWIATAMSLIFWNRGAFCGWLCPFGALQELTNQLAQKLHIPQIKVPHGLN
TRLAGLKYIIFLILFGISLYELGLAEKFSEVEPFKTAIILKFIREWPFVIFAVVLLLAGL
FIERFYCRYLCPLGAALAIPARLRIFDWLRRYKTCGNPCQLCAVDCPVQAINPEGDINPN
ECIQCLNCQQLYHNEKRCPHLIQKNAKLKRNKTPPPDAGIPGEVIASRKPTVRPRTADDA
ATPVSSNP