Protein Info for ABCV34_RS01490 in Castellaniella sp019104865 MT123

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 6 to 35 (30 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 173 to 200 (28 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 363 to 387 (25 residues), see Phobius details amino acids 399 to 424 (26 residues), see Phobius details PF06808: DctM" amino acids 11 to 423 (413 residues), 269 bits, see alignment E=3.6e-84 TIGR00786: TRAP transporter, DctM subunit" amino acids 21 to 428 (408 residues), 384.4 bits, see alignment E=2.9e-119

Best Hits

KEGG orthology group: None (inferred from 79% identity to ctt:CtCNB1_0560)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>ABCV34_RS01490 TRAP transporter large permease subunit (Castellaniella sp019104865 MT123)
MNEITASIALIVVLFTLLGGGVWVGLALAGVALFGMEFFSARPAGDAMAITIWGSSSSWT
LTALPLFIWMGEILYRTNLSENLFRGLAPWVNRLPGRLLHTNVLGCTIFASVCGSSAATC
VTVGKMNLPELRKRGYPDAQIIGSLGGPATLGLLIPPSIILIVYGVAAETSIAKLFIAGV
IPGLLLAALFSGWLAGWALLHPSQVPESAGNLSLLEKLRESRQLIPVVLLILGVIVSIYS
GVATATESAAIGVLGAFLLSAWQKSLTWQSFRDSLLGASRLYCMIALILAGAAFMTLSMG
YIGLPRQLAEFVGSLHLSPAMLIVALGLFYIVLGCFLDGISTIVLTMGVVLPIIQAAGID
PIWFGIFLVITVETAQITPPVGFNLFVLQSMTAKEITYIARVCAPYFGLMMLLLVVLWFF
PGLATWLPSHM