Protein Info for ABCV34_RS01405 in Castellaniella sp019104865 MT123

Annotation: branched-chain amino acid ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 218 to 245 (28 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 5 to 274 (270 residues), 123 bits, see alignment E=1.9e-39 PF00005: ABC_tran" amino acids 342 to 502 (161 residues), 104.9 bits, see alignment E=8.5e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>ABCV34_RS01405 branched-chain amino acid ABC transporter ATP-binding protein/permease (Castellaniella sp019104865 MT123)
MNYWANVVNIILIYSILGISLNLVLGFSGMVSMAHAVYFGVAAYAVALLSINLGMDFPYA
AIIAVIFAGLFAAITAFPALRVRDEYLILLTLALQMIVSGIMDAWLSVTGGPSGIPGIPP
IGIGSLVLISPIQLLPLLLAVTAVVFLVAQKITCSSFGRALKAMRENESAAIAAGKNIVL
LKVIVFGVSGLIAGVAGALFAGAQGFIDPLSFNLDTSIMIIALVALGGAANLYGTIVGAI
LIFGLPELLTFFNTGSTDTVSASRGIIFGLLLILFTRFRPQGIIPERAFNQKRYSQRPPQ
RANRTNSTFDGPEPGQSAATLGQASLEAVDLNKRFGGVVTAKNVNLVLKPGMVTALIGPN
GAGKTTIFNLLAGALRPDSGRIAVRGRDITTMPAWRRVPEGIGRSFQDVRIFENISVIDN
VLVALPSAHSESLFNLFFKPSRQRLLEQQNQSKAMALLEQVGLCDKAFESAGDLSYGEQK
LLAIARLVATGADILLFDEPAAGVDAVWASKMIEIIRALAQSGKAVCLVEHNLNVVRELA
DVIYFMNVGNIVTKGTPDEIMRNTELADIYFGQEAIKD