Protein Info for ABCV34_RS01255 in Castellaniella sp019104865 MT123

Annotation: zinc-dependent alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 165 to 185 (21 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details TIGR02822: zinc-binding alcohol dehydrogenase family protein" amino acids 12 to 326 (315 residues), 347.6 bits, see alignment E=3.4e-108 PF08240: ADH_N" amino acids 24 to 134 (111 residues), 103.4 bits, see alignment E=3.6e-34

Best Hits

Swiss-Prot: 48% identical to ADHA_MYCTO: Probable alcohol dehydrogenase AdhA (adhA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K13953, alcohol dehydrogenase, propanol-preferring [EC: 1.1.1.1] (inferred from 77% identity to bmr:BMI_I1066)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABCV34_RS01255 zinc-dependent alcohol dehydrogenase family protein (Castellaniella sp019104865 MT123)
MKAMIFEKSGMPLSPVERPDPLPGPGEIRLRVEACAVCRTDLHIVDGDLPHPKLPLILGH
EVVGIVDAVGPGVDRARLGHRVGVPWLGHTCGTCRYCSTGAENLCDTPIFTGYTRDGGFA
THTVADADFAFPLDEDAAPASLAPLLCAGLIGWRSLKKAGDGERIGLYGFGAAAHILAQI
CAWQGRRVFAFTRRGDAQAQRFAMDLGAVWAGASDEMPPEPLDAAIIFAPVGALVPCALR
AVRKGGRVVCGGIHMSDIPAMPYAVLWEERKLASVANLTRQDAHEFFPTASAAGIRTRTT
IYGLEDANRALADLRAGRLDGAAVIVP