Protein Info for ABCV34_RS01220 in Castellaniella sp019104865 MT123

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF02826: 2-Hacid_dh_C" amino acids 12 to 101 (90 residues), 28.1 bits, see alignment E=3.1e-10 PF07991: IlvN" amino acids 14 to 177 (164 residues), 252.3 bits, see alignment E=4.2e-79 TIGR00465: ketol-acid reductoisomerase" amino acids 14 to 326 (313 residues), 442.4 bits, see alignment E=3.8e-137 PF03807: F420_oxidored" amino acids 18 to 91 (74 residues), 30.6 bits, see alignment E=1.1e-10 PF03446: NAD_binding_2" amino acids 18 to 103 (86 residues), 30.8 bits, see alignment E=7.3e-11 PF01450: IlvC" amino acids 183 to 326 (144 residues), 212.7 bits, see alignment E=6.5e-67

Best Hits

Swiss-Prot: 88% identical to ILVC_BORA1: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Bordetella avium (strain 197N)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 88% identity to axy:AXYL_01240)

MetaCyc: 85% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>ABCV34_RS01220 ketol-acid reductoisomerase (Castellaniella sp019104865 MT123)
MKVFYDKDCDLSLIKGKQVAIIGYGSQGHAHAQNLHDSGVKVTVGLRKGGASWKKAEGAG
LSVKEVAEAVKGADVVMMLLPDEHIAEVYRTQIAANLKSGAALAFAHGFNVHYGQVVPRA
DIDVIMIAPKAPGHTVRSTYKQGGGVPHLVAVHQDVSGKARDLALSYAMGNGGGRAGIIE
TNFREETETDLFGEQAVLCGGTVELIKAGFQTLVEAGYAPEMAYFECLHELKLIVDLIYE
GGIANMNYSISNNAEYGEYVTGPRIVTDETRAAMRQCLTDIQTGVYAKNFILENAAGAPE
LTSRRRLNAESQIEQVGGKLRAMMPWIAANKLVDQSKN