Protein Info for ABCV34_RS01060 in Castellaniella sp019104865 MT123

Annotation: bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00165: HTH_AraC" amino acids 51 to 81 (31 residues), 37.7 bits, see alignment (E = 2.6e-13) PF12833: HTH_18" amino acids 55 to 132 (78 residues), 61.6 bits, see alignment E=1.1e-20 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 219 to 298 (80 residues), 113.7 bits, see alignment E=1.6e-37 PF01035: DNA_binding_1" amino acids 220 to 299 (80 residues), 120.3 bits, see alignment E=3.9e-39

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 77% identity to bur:Bcep18194_A4931)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>ABCV34_RS01060 bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada (Castellaniella sp019104865 MT123)
MMDARETAEAQTAADRLGHRAEGHRTAAAMAHSALVARACRLIESSEIPPTLDALAARAG
MSPFHFHRVFKAETGLTPKAYAVAYRARRLREALSAGGTVTDAIYGAGYNSSSRFYETSG
CVLGMRAGEYRAGGTGTVIRFAVGQCSLGAILVAQSQRGVCAILLGDDPDRLVRDLQDQF
PRAGLIGGDGGFEQLVAQVVGFVEAPAIGLNLPLDVRGTAFQQRVWQALRRIPPGATVSY
AEIAERIGAPKAARAVARACAANHLAVAIPCHRVVRQDGGISGYRWGVDRKRELLRREAH
A