Protein Info for ABCV34_RS01030 in Castellaniella sp019104865 MT123

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details amino acids 407 to 430 (24 residues), see Phobius details amino acids 457 to 479 (23 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 419 (398 residues), 138.5 bits, see alignment E=1.3e-44 amino acids 281 to 446 (166 residues), 43.3 bits, see alignment E=1.2e-15

Best Hits

KEGG orthology group: K08170, MFS transporter, DHA2 family, multidrug resistance protein (inferred from 71% identity to ade:Adeh_0552)

Predicted SEED Role

"Zinc transport protein ZntB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>ABCV34_RS01030 MFS transporter (Castellaniella sp019104865 MT123)
MGTNPQAGQAYKGNDRLLFGIILGVVAFWLFAQTTLNIAPDMGRTLGVDASVMNVAVAIT
SLFSGIFIVVVGGLADRVGRLKITRIGFYLSIVGSLLVAITPQGYLAAPVILLGRALQGL
SAACIMPASLALVKAFWDEGPDRQRAISMWSIGSWGGSGLCSLVGGLMSQNFGWRSIFWV
DIVICLLGLWMMRGAPESKVETKGEYKFDLSGVLTFMVTMVALQVLVTQGNKLGWTSPIG
LVLWVVLIVFGWMFLRIESKKSTAFFDFKLFKNATYTGATISNFLINGTAGTLIVSLQLV
QIGGGMNAEQAGFLTLGYAVAIIAFIRVGEKLLQRFGPRKPMIWGCLITGLAIILVSPAN
LMLSDYKVFASVGYALFGVGLAFYATPSTDAALSNLPAAQTGSGSGIYKMASSLGAAFGV
AISAAIFTALNGNGADWLAGTITFVGRQDNLAVREAAMIALGFNVLMVAVAILSIMLTIP
KGTKTRA