Protein Info for ABCV34_RS00795 in Castellaniella sp019104865 MT123

Annotation: 3-deoxy-8-phosphooctulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00793: DAHP_synth_1" amino acids 8 to 273 (266 residues), 237.6 bits, see alignment E=6.1e-75 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 13 to 274 (262 residues), 402 bits, see alignment E=4.3e-125

Best Hits

Swiss-Prot: 82% identical to KDSA_BORPE: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 81% identity to put:PT7_1657)

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>ABCV34_RS00795 3-deoxy-8-phosphooctulonate synthase (Castellaniella sp019104865 MT123)
MQLCHFQAGLEHPLFLIAGPCVIESRELAFETAGILQEMTRTLGIPFIYKSSFDKANRSS
GASFRGPGMDEGLKILDDVRRQLGVPVLTDVHETGQAREVASVVDVLQTPAFLCRQTDFI
QACAATLKPVNIKKGQFLAPEDMKQVVTKARAAAIEAGGDGRNILVCERGASFGYHNLVS
DMRSLAIMRDTHCPVVFDATHSVQLPGGQGTHSGGQREFVPVLARAAVAVGIAGVFMETH
PNPEKALSDGPNAVPLGKMRELLETLVALDRCVKQGGAAALSL