Protein Info for ABCV34_RS00640 in Castellaniella sp019104865 MT123

Annotation: MaoC family dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details PF01575: MaoC_dehydratas" amino acids 8 to 107 (100 residues), 63.1 bits, see alignment E=1.9e-21 PF13452: MaoC_dehydrat_N" amino acids 9 to 134 (126 residues), 35.1 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: None (inferred from 74% identity to put:PT7_2040)

Predicted SEED Role

"Acyl dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>ABCV34_RS00640 MaoC family dehydratase (Castellaniella sp019104865 MT123)
MKFKEFEPGMVIHHGPVTVTEAEMLAFARSYDPQWFHVDEKRARDSRWGGLIASGWMTCG
LAMRMAFESALHDSESFGSPGLERLRWILPVRPGDQLRLEATVDSRRISSSREDLGIMRW
TWRLFNQADEQVLEVEVTSLFELELPDRA